LYSMD2,MGC35274
  • LYSMD2,MGC35274

Anti-LYSMD2 Antibody 25ul

Ref: AN-HPA040460-25ul
Anti-LYSMD2

Información del producto

Polyclonal Antibody against Human LYSMD2, Gene description: LysM, putative peptidoglycan-binding, domain containing 2, Alternative Gene Names: MGC35274, Validated applications: ICC, IHC, Uniprot ID: Q8IV50, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name LYSMD2
Gene Description LysM, putative peptidoglycan-binding, domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLY
Immunogen LNIPVISEKPLLFNGLNSIDSPENETADNSFSQEEEPVVAGEDLPPPSPQESDVQPVQPEEVSARDFLQRLDLQIKLSTQAAKKLKEESRDEESPYATSLY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC35274
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IV50
HTS Code 3002150000
Gene ID 256586
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-LYSMD2 Antibody 25ul

Anti-LYSMD2 Antibody 25ul