COG6,COD2,KIAA1134
  • COG6,COD2,KIAA1134

Anti-COG6 Antibody 100ul

Ref: AN-HPA040410-100ul
Anti-COG6

Información del producto

Polyclonal Antibody against Human COG6, Gene description: component of oligomeric golgi complex 6, Alternative Gene Names: COD2, KIAA1134, Validated applications: IHC, WB, Uniprot ID: Q9Y2V7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name COG6
Gene Description component of oligomeric golgi complex 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence HLEALLKHVTTQGVEENIQEVVGHITEGVCRPLKVRIEQVIVAEPGAVLLYKISNLLKFYHHTISGIVGNSATALLTTIEEMHLLSKKIFFNSLSLHASKL
Immunogen HLEALLKHVTTQGVEENIQEVVGHITEGVCRPLKVRIEQVIVAEPGAVLLYKISNLLKFYHHTISGIVGNSATALLTTIEEMHLLSKKIFFNSLSLHASKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names COD2, KIAA1134
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2V7
HTS Code 3002150000
Gene ID 57511
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-COG6 Antibody 100ul

Anti-COG6 Antibody 100ul