SPG21,ACP33,BM-019
  • SPG21,ACP33,BM-019

Anti-SPG21 Antibody 25ul

Ref: AN-HPA040407-25ul
Anti-SPG21

Información del producto

Polyclonal Antibody against Human SPG21, Gene description: spastic paraplegia 21 (autosomal recessive, Mast syndrome), Alternative Gene Names: ACP33, BM-019, GL010, MAST, Validated applications: ICC, WB, Uniprot ID: Q9NZD8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPG21
Gene Description spastic paraplegia 21 (autosomal recessive, Mast syndrome)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Immunogen AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ACP33, BM-019, GL010, MAST
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NZD8
HTS Code 3002150000
Gene ID 51324
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPG21 Antibody 25ul

Anti-SPG21 Antibody 25ul