CEP57L1,bA487F23.2
  • CEP57L1,bA487F23.2

Anti-CEP57L1 Antibody 25ul

Ref: AN-HPA040378-25ul
Anti-CEP57L1

Información del producto

Polyclonal Antibody against Human CEP57L1, Gene description: centrosomal protein 57kDa-like 1, Alternative Gene Names: bA487F23.2, C6orf182, MGC21731, Validated applications: ICC, IHC, WB, Uniprot ID: Q8IYX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CEP57L1
Gene Description centrosomal protein 57kDa-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC, IHC
Sequence SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
Immunogen SKKTKCIKRRPPWQICSKFGALPFVAEKMRQHRDPHILQKPFNVTETRCLPKPSRTTSWCKAIPPDSEKSISICDNLSELLMAMQDELDQMSMEHQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA487F23.2, C6orf182, MGC21731
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IYX8
HTS Code 3002150000
Gene ID 285753
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CEP57L1 Antibody 25ul

Anti-CEP57L1 Antibody 25ul