OGFOD2,FLJ13491
  • OGFOD2,FLJ13491

Anti-OGFOD2 Antibody 25ul

Ref: AN-HPA040306-25ul
Anti-OGFOD2

Información del producto

Polyclonal Antibody against Human OGFOD2, Gene description: 2-oxoglutarate and iron-dependent oxygenase domain containing 2, Alternative Gene Names: FLJ13491, FLJ37501, Validated applications: ICC, IHC, WB, Uniprot ID: Q6N063, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name OGFOD2
Gene Description 2-oxoglutarate and iron-dependent oxygenase domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence ARPEVYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYG
Immunogen ARPEVYDSLQDAALAPEFLAVTEYSVSPDADLKGLLQRLETVSEEKRIYRVPVFTAPFCQALLEELEHFEQSDMPKGRPNTMNNYG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ13491, FLJ37501
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6N063
HTS Code 3002150000
Gene ID 79676
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-OGFOD2 Antibody 25ul

Anti-OGFOD2 Antibody 25ul