STAMBPL1,ALMalpha
  • STAMBPL1,ALMalpha

Anti-STAMBPL1 Antibody 25ul

Ref: AN-HPA040202-25ul
Anti-STAMBPL1

Información del producto

Polyclonal Antibody against Human STAMBPL1, Gene description: STAM binding protein-like 1, Alternative Gene Names: ALMalpha, AMSH-FP, AMSH-LP, bA399O19.2, FLJ31524, KIAA1373, Validated applications: ICC, IHC, Uniprot ID: Q96FJ0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STAMBPL1
Gene Description STAM binding protein-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
Immunogen LKKYNVEYQEYLQSKNKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ALMalpha, AMSH-FP, AMSH-LP, bA399O19.2, FLJ31524, KIAA1373
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96FJ0
HTS Code 3002150000
Gene ID 57559
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-STAMBPL1 Antibody 25ul

Anti-STAMBPL1 Antibody 25ul