KCNK6,K2p6.1,TWIK-2
  • KCNK6,K2p6.1,TWIK-2

Anti-KCNK6 Antibody 100ul

Ref: AN-HPA040184-100ul
Anti-KCNK6

Información del producto

Polyclonal Antibody against Human KCNK6, Gene description: potassium channel, subfamily K, member 6, Alternative Gene Names: K2p6.1, TWIK-2, Validated applications: IHC, Uniprot ID: Q9Y257, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KCNK6
Gene Description potassium channel, subfamily K, member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDY
Immunogen LQTFRHVSDLHGLTELILLPPPCPASFNADEDDRVDILGPQPESHQQLSASSHTDY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names K2p6.1, TWIK-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y257
HTS Code 3002150000
Gene ID 9424
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KCNK6 Antibody 100ul

Anti-KCNK6 Antibody 100ul