FAM222A,C12orf34
  • FAM222A,C12orf34

Anti-FAM222A Antibody 25ul

Ref: AN-HPA040181-25ul
Anti-FAM222A

Información del producto

Polyclonal Antibody against Human FAM222A, Gene description: family with sequence similarity 222, member A, Alternative Gene Names: C12orf34, FLJ14721, Validated applications: ICC, IHC, WB, Uniprot ID: Q5U5X8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name FAM222A
Gene Description family with sequence similarity 222, member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKP
Immunogen PSIHSLLYQLNQQCQAPGAAPPACQGMAIPHPSPAKHGPVPSFPSMAYSAAAGLPDCRKGTELGQGATQALTLAGAAKPAGYADSGLDYLLWPQKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12orf34, FLJ14721
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5U5X8
HTS Code 3002150000
Gene ID 84915
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FAM222A Antibody 25ul

Anti-FAM222A Antibody 25ul