MAST2,KIAA0807
  • MAST2,KIAA0807

Anti-MAST2 Antibody 100ul

Ref: AN-HPA040155-100ul
Anti-MAST2

Información del producto

Polyclonal Antibody against Human MAST2, Gene description: microtubule associated serine/threonine kinase 2, Alternative Gene Names: KIAA0807, MAST205, Validated applications: IHC, Uniprot ID: Q6P0Q8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MAST2
Gene Description microtubule associated serine/threonine kinase 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS
Immunogen LLFRKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRMRNQS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0807, MAST205
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P0Q8
HTS Code 3002150000
Gene ID 23139
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MAST2 Antibody 100ul

Anti-MAST2 Antibody 100ul