CHURC1,C14orf52
  • CHURC1,C14orf52

Anti-CHURC1 Antibody 100ul

Ref: AN-HPA040072-100ul
Anti-CHURC1

Información del producto

Polyclonal Antibody against Human CHURC1, Gene description: churchill domain containing 1, Alternative Gene Names: C14orf52, FLJ33064, My015, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WUH1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CHURC1
Gene Description churchill domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence GDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDP
Immunogen GDCVEKEYPNRGNTCLENGSFLLNFTGCAVCSKRDFMLITNKSLKEEDGEEIVTYDHLCKNCHHVIARHEYTFSIMDEFQEYTMLCLLCGKAEDTISILPDDP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C14orf52, FLJ33064, My015
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WUH1
HTS Code 3002150000
Gene ID 91612
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHURC1 Antibody 100ul

Anti-CHURC1 Antibody 100ul