GOLGA3,GCP170
  • GOLGA3,GCP170

Anti-GOLGA3 Antibody 100ul

Ref: AN-HPA040044-100ul
Anti-GOLGA3

Información del producto

Polyclonal Antibody against Human GOLGA3, Gene description: golgin A3, Alternative Gene Names: GCP170, golgin-160, MEA-2, Validated applications: ICC, IHC, WB, Uniprot ID: Q08378, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GOLGA3
Gene Description golgin A3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Immunogen TTLTSKLKASQAEISSLQSVRQWYQQQLALAQEARVRLQGEMAHIQVGQMTQAGLLEHLKLENVSLSQQLTETQHRSMKEKGRIAAQLQGIEADMLDQEAA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GCP170, golgin-160, MEA-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q08378
HTS Code 3002150000
Gene ID 2802
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-GOLGA3 Antibody 100ul

Anti-GOLGA3 Antibody 100ul