DCTN2,DCTN-50,RBP50
  • DCTN2,DCTN-50,RBP50

Anti-DCTN2 Antibody 100ul

Ref: AN-HPA040040-100ul
Anti-DCTN2

Información del producto

Polyclonal Antibody against Human DCTN2, Gene description: dynactin 2 (p50), Alternative Gene Names: DCTN-50, RBP50, Validated applications: IHC, WB, Uniprot ID: Q13561, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DCTN2
Gene Description dynactin 2 (p50)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Immunogen RWSPIASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DCTN-50, RBP50
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q13561
HTS Code 3002150000
Gene ID 10540
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DCTN2 Antibody 100ul

Anti-DCTN2 Antibody 100ul