SSFA2,CS-1,KIAA1927
  • SSFA2,CS-1,KIAA1927

Anti-SSFA2 Antibody 100ul

Ref: AN-HPA039989-100ul
Anti-SSFA2

Información del producto

Polyclonal Antibody against Human SSFA2, Gene description: sperm specific antigen 2, Alternative Gene Names: CS-1, KIAA1927, KRAP, SPAG13, Validated applications: IHC, Uniprot ID: P28290, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SSFA2
Gene Description sperm specific antigen 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EECHHGRTPTCSRLAPPPMSQSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNP
Immunogen EECHHGRTPTCSRLAPPPMSQSTCSLHSIHSEWQERPLCEHTRTLSTHSVPNISGATCSAFASPFGCPYSHRHATYPYRVCSVNP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CS-1, KIAA1927, KRAP, SPAG13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P28290
HTS Code 3002150000
Gene ID 6744
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SSFA2 Antibody 100ul

Anti-SSFA2 Antibody 100ul