TIMM10,TIM10,TIM10A
  • TIMM10,TIM10,TIM10A

Anti-TIMM10 Antibody 100ul

Ref: AN-HPA039946-100ul
Anti-TIMM10

Información del producto

Polyclonal Antibody against Human TIMM10, Gene description: translocase of inner mitochondrial membrane 10 homolog (yeast), Alternative Gene Names: TIM10, TIM10A, Validated applications: ICC, IHC, Uniprot ID: P62072, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TIMM10
Gene Description translocase of inner mitochondrial membrane 10 homolog (yeast)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Immunogen MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TIM10, TIM10A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P62072
HTS Code 3002150000
Gene ID 26519
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TIMM10 Antibody 100ul

Anti-TIMM10 Antibody 100ul