NDUFAF1,CGI-65,CIA30
  • NDUFAF1,CGI-65,CIA30

Anti-NDUFAF1 Antibody 100ul

Ref: AN-HPA039933-100ul
Anti-NDUFAF1

Información del producto

Polyclonal Antibody against Human NDUFAF1, Gene description: NADH dehydrogenase (ubiquinone) complex I, assembly factor 1, Alternative Gene Names: CGI-65, CIA30, Validated applications: ICC, IHC, Uniprot ID: Q9Y375, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFAF1
Gene Description NADH dehydrogenase (ubiquinone) complex I, assembly factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence SYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKI
Immunogen SYDWSQFNTLYLRVRGDGRPWMVNIKEDTDFFQRTNQMYSYFMFTRGGPYWQEVKIPFSKFFFSNRGRIRDVQHELPLDKI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-65, CIA30
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y375
HTS Code 3002150000
Gene ID 51103
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFAF1 Antibody 100ul

Anti-NDUFAF1 Antibody 100ul