MRPL51,bMRP64,CDA09
  • MRPL51,bMRP64,CDA09

Anti-MRPL51 Antibody 100ul

Ref: AN-HPA039923-100ul
Anti-MRPL51

Información del producto

Polyclonal Antibody against Human MRPL51, Gene description: mitochondrial ribosomal protein L51, Alternative Gene Names: bMRP64, CDA09, HSPC241, MRP64, Validated applications: ICC, IHC, WB, Uniprot ID: Q4U2R6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MRPL51
Gene Description mitochondrial ribosomal protein L51
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
Immunogen GNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKHFNR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bMRP64, CDA09, HSPC241, MRP64
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q4U2R6
HTS Code 3002150000
Gene ID 51258
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MRPL51 Antibody 100ul

Anti-MRPL51 Antibody 100ul