CCDC84,DLNB14
  • CCDC84,DLNB14

Anti-CCDC84 Antibody 100ul

Ref: AN-HPA039906-100ul
Anti-CCDC84

Información del producto

Polyclonal Antibody against Human CCDC84, Gene description: coiled-coil domain containing 84, Alternative Gene Names: DLNB14, Validated applications: IHC, WB, Uniprot ID: Q86UT8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC84
Gene Description coiled-coil domain containing 84
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPP
Immunogen KEKFLVTPQDYARFKKSMVKGLDSYEEKEDKVIKEMAAQIREVEQSRQEVVRSVLEPQAVPDPEEGSSAPRSWKGMNSQVASSLQQPSNLDLPP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DLNB14
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86UT8
HTS Code 3002150000
Gene ID 338657
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCDC84 Antibody 100ul

Anti-CCDC84 Antibody 100ul