NDUFA12,B17.2,DAP13
  • NDUFA12,B17.2,DAP13

Anti-NDUFA12 Antibody 100ul

Ref: AN-HPA039903-100ul
Anti-NDUFA12

Información del producto

Polyclonal Antibody against Human NDUFA12, Gene description: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12, Alternative Gene Names: B17.2, DAP13, Validated applications: ICC, IHC, WB, Uniprot ID: Q9UI09, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NDUFA12
Gene Description NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
Immunogen MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names B17.2, DAP13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UI09
HTS Code 3002150000
Gene ID 55967
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NDUFA12 Antibody 100ul

Anti-NDUFA12 Antibody 100ul