TTC23,FLJ12572,HCC-8
  • TTC23,FLJ12572,HCC-8

Anti-TTC23 Antibody 100ul

Ref: AN-HPA039806-100ul
Anti-TTC23

Información del producto

Polyclonal Antibody against Human TTC23, Gene description: tetratricopeptide repeat domain 23, Alternative Gene Names: FLJ12572, HCC-8, Validated applications: ICC, IHC, WB, Uniprot ID: Q5W5X9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TTC23
Gene Description tetratricopeptide repeat domain 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence LRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP
Immunogen LRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12572, HCC-8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5W5X9
HTS Code 3002150000
Gene ID 64927
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TTC23 Antibody 100ul

Anti-TTC23 Antibody 100ul