RUFY2,FLJ10063
  • RUFY2,FLJ10063

Anti-RUFY2 Antibody 100ul

Ref: AN-HPA039792-100ul
Anti-RUFY2

Información del producto

Polyclonal Antibody against Human RUFY2, Gene description: RUN and FYVE domain containing 2, Alternative Gene Names: FLJ10063, KIAA1537, RABIP4R, ZFYVE13, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WXA3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RUFY2
Gene Description RUN and FYVE domain containing 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence EKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQE
Immunogen EKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10063, KIAA1537, RABIP4R, ZFYVE13
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WXA3
HTS Code 3002150000
Gene ID 55680
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RUFY2 Antibody 100ul

Anti-RUFY2 Antibody 100ul