MTIF3,IF-3mt,IF3(mt)
  • MTIF3,IF-3mt,IF3(mt)

Anti-MTIF3 Antibody 100ul

Ref: AN-HPA039791-100ul
Anti-MTIF3

Información del producto

Polyclonal Antibody against Human MTIF3, Gene description: mitochondrial translational initiation factor 3, Alternative Gene Names: IF-3mt, IF3(mt), Validated applications: ICC, IHC, WB, Uniprot ID: Q9H2K0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name MTIF3
Gene Description mitochondrial translational initiation factor 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB, ICC
Sequence KHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Immunogen KHLVQITIKKGKNVDVSENEMEEIFHQILQTMPGIATFSSRPQAVQGGKALMCVLRALSKNEEKAYKETQETQERDTLNKDHGNDKESNVLHQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names IF-3mt, IF3(mt)
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H2K0
HTS Code 3002150000
Gene ID 219402
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-MTIF3 Antibody 100ul

Anti-MTIF3 Antibody 100ul