DNAH10OS,FLJ45278
  • DNAH10OS,FLJ45278

Anti-DNAH10OS Antibody 100ul

Ref: AN-HPA039786-100ul
Anti-DNAH10OS

Información del producto

Polyclonal Antibody against Human DNAH10OS, Gene description: dynein, axonemal, heavy chain 10 opposite strand, Alternative Gene Names: FLJ45278, Validated applications: IHC, Uniprot ID: P0CZ25, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DNAH10OS
Gene Description dynein, axonemal, heavy chain 10 opposite strand
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL
Immunogen MVPESEWAPWQPQLPCEPKWLGSRKSKPHRESGLRGGGPSRCAKRGTHSCGPRESGGPDTCHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ45278
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P0CZ25
HTS Code 3002150000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DNAH10OS Antibody 100ul

Anti-DNAH10OS Antibody 100ul