RAB3IL1
  • RAB3IL1

Anti-RAB3IL1 Antibody 100ul

Ref: AN-HPA039723-100ul
Anti-RAB3IL1

Información del producto

Polyclonal Antibody against Human RAB3IL1, Gene description: RAB3A interacting protein (rabin3)-like 1, Validated applications: ICC, IHC, Uniprot ID: Q8TBN0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAB3IL1
Gene Description RAB3A interacting protein (rabin3)-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDSPPQPDQGLPPPLAAVPV
Immunogen MDSSEEHAGCPARGTCPVFLAMSAGTVRYAPSGLCPVLEGNLREEPWGTDSPPQPDQGLPPPLAAVPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBN0
HTS Code 3002150000
Gene ID 5866
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RAB3IL1 Antibody 100ul

Anti-RAB3IL1 Antibody 100ul