SLC7A1,ATRC1,CAT-1
  • SLC7A1,ATRC1,CAT-1

Anti-SLC7A1 Antibody 100ul

Ref: AN-HPA039721-100ul
Anti-SLC7A1

Información del producto

Polyclonal Antibody against Human SLC7A1, Gene description: solute carrier family 7 (cationic amino acid transporter, y+ system), member 1, Alternative Gene Names: ATRC1, CAT-1, ERR, HCAT1, REC1L, Validated applications: WB, Uniprot ID: P30825, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SLC7A1
Gene Description solute carrier family 7 (cationic amino acid transporter, y+ system), member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB
Sequence QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
Immunogen QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ATRC1, CAT-1, ERR, HCAT1, REC1L
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30825
HTS Code 3002150000
Gene ID 6541
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SLC7A1 Antibody 100ul

Anti-SLC7A1 Antibody 100ul