C11orf45,FLJ43646
  • C11orf45,FLJ43646

Anti-C11orf45 Antibody 100ul

Ref: AN-HPA039716-100ul
Anti-C11orf45

Información del producto

Polyclonal Antibody against Human C11orf45, Gene description: chromosome 11 open reading frame 45, Alternative Gene Names: FLJ43646, MGC35558, Validated applications: ICC, IHC, WB, Uniprot ID: Q8TAV5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C11orf45
Gene Description chromosome 11 open reading frame 45
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
Immunogen SSAVYTHGCGCVRSATNITCQSSGQQRQAARQEEENSICKAHDSREGRLGYPLSAHQPGSGGPN
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ43646, MGC35558
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TAV5
HTS Code 3002150000
Gene ID 219833
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-C11orf45 Antibody 100ul

Anti-C11orf45 Antibody 100ul