KRT84,Hb-4,KRTHB4
  • KRT84,Hb-4,KRTHB4

Anti-KRT84 Antibody 25ul

Ref: AN-HPA039714-25ul
Anti-KRT84

Información del producto

Polyclonal Antibody against Human KRT84, Gene description: keratin 84, type II, Alternative Gene Names: Hb-4, KRTHB4, Validated applications: IHC, Uniprot ID: Q9NSB2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KRT84
Gene Description keratin 84, type II
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence CGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAV
Immunogen CGVRFGAGCGMGFGDGRGVGLGPRADSCVGLGFGAGSGIGYGFGGPGFGYRVGGVGVPAAPSITAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Hb-4, KRTHB4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NSB2
HTS Code 3002150000
Gene ID 3890
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KRT84 Antibody 25ul

Anti-KRT84 Antibody 25ul