DNHD1,C11orf47 Ver mas grande

Anti-DNHD1 Antibody 100ul

AN-HPA039698-100ul

Producto nuevo

Anti-DNHD1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 5 Biopuntos. Su cesta contiene un total 5 Biopuntos puede ser convertido en un Biobonos Descuento 20.00EUR.


Añadir a Mis Favoritos

Hoja técnica

Size 100ul
Gene Name DNHD1
Gene Description dynein heavy chain domain 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
Immunogen KHSQATQPMLILLPPPGHPSATLHPLTVIQKLAAKYQQGQKQLQVIALGSEAWDPVSVVVSTLSQAMYEGHWLVLDNCHLMPHW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C11orf47, CCDC35, DHCD1, DKFZp686J0796, DNHD1L, FLJ32752, FLJ35709, FLJ46184
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96M86
HTS Code 3002150000
Gene ID 144132
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Aplicación IHC
Conjugation Unconjugated

Más información

Polyclonal Antibody against Human DNHD1, Gene description: dynein heavy chain domain 1, Alternative Gene Names: C11orf47, CCDC35, DHCD1, DKFZp686J0796, DNHD1L, FLJ32752, FLJ35709, FLJ46184, Validated applications: IHC, Uniprot ID: Q96M86, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image