ADH7,ADH-4
  • ADH7,ADH-4

Anti-ADH7 Antibody 25ul

Ref: AN-HPA039695-25ul
Anti-ADH7

Información del producto

Polyclonal Antibody against Human ADH7, Gene description: alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide, Alternative Gene Names: ADH-4, Validated applications: IHC, WB, Uniprot ID: P40394, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ADH7
Gene Description alcohol dehydrogenase 7 (class IV), mu or sigma polypeptide
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC
Sequence KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
Immunogen KFEKAMAVGATECISPKDSTKPISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADH-4
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P40394
HTS Code 3002150000
Gene ID 131
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ADH7 Antibody 25ul

Anti-ADH7 Antibody 25ul