RASSF9,P-CIP1,PAMCI
  • RASSF9,P-CIP1,PAMCI

Anti-RASSF9 Antibody 25ul

Ref: AN-HPA039678-25ul
Anti-RASSF9

Información del producto

Polyclonal Antibody against Human RASSF9, Gene description: Ras association (RalGDS/AF-6) domain family (N-terminal) member 9, Alternative Gene Names: P-CIP1, PAMCI, Validated applications: IHC, WB, Uniprot ID: O75901, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RASSF9
Gene Description Ras association (RalGDS/AF-6) domain family (N-terminal) member 9
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications IHC, WB
Sequence YRILIDKLSAEIEKEVKSVCIDINEDAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEY
Immunogen YRILIDKLSAEIEKEVKSVCIDINEDAEGEAASELESSNLESVKCDLEKSMKAGLKIHSHLSGIQKEIKYSDSLLQMKAKEY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names P-CIP1, PAMCI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O75901
HTS Code 3002150000
Gene ID 9182
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RASSF9 Antibody 25ul

Anti-RASSF9 Antibody 25ul