PARPBP,C12orf48
  • PARPBP,C12orf48

Anti-PARPBP Antibody 100ul

Ref: AN-HPA039677-100ul
Anti-PARPBP

Información del producto

Polyclonal Antibody against Human PARPBP, Gene description: PARP1 binding protein, Alternative Gene Names: C12orf48, FLJ20641, PARI, Validated applications: ICC, IHC, Uniprot ID: Q9NWS1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PARPBP
Gene Description PARP1 binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence RALTSNCENYNTVSPSQLLDFLSGKQYAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVA
Immunogen RALTSNCENYNTVSPSQLLDFLSGKQYAVGDETDLSIPTSPTSKYNRDNEKVQLLARKIIFSYLNLLVNSKNDLAVA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12orf48, FLJ20641, PARI
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWS1
HTS Code 3002150000
Gene ID 55010
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-PARPBP Antibody 100ul

Anti-PARPBP Antibody 100ul