UBLCP1,CPUB1
  • UBLCP1,CPUB1

Anti-UBLCP1 Antibody 25ul

Ref: AN-HPA039615-25ul
Anti-UBLCP1

Información del producto

Polyclonal Antibody against Human UBLCP1, Gene description: ubiquitin-like domain containing CTD phosphatase 1, Alternative Gene Names: CPUB1, MGC10067, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WVY7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UBLCP1
Gene Description ubiquitin-like domain containing CTD phosphatase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications ICC, IHC, WB
Sequence SLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETG
Immunogen SLEDVLGPPPDNDDVVNDFDIEDEVVEVENREENLLKISRRVKEYKVEILNPPREGKKLLVLDVDYTLFDHRSCAETG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CPUB1, MGC10067
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVY7
HTS Code 3002150000
Gene ID 134510
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UBLCP1 Antibody 25ul

Anti-UBLCP1 Antibody 25ul