TAZ,BTHS,CMD3A,EFE
  • TAZ,BTHS,CMD3A,EFE

Anti-TAZ Antibody 25ul

Ref: AN-HPA039557-25ul
Anti-TAZ

Información del producto

Polyclonal Antibody against Human TAZ, Gene description: tafazzin, Alternative Gene Names: BTHS, CMD3A, EFE, EFE2, G4.5, XAP-2, Validated applications: IHC, Uniprot ID: Q16635, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAZ
Gene Description tafazzin
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP
Immunogen WHVGMNDVLPNSPPYFPRFGQKITVLIGKPFSALPVLERLRAENKSAVEMRKALTDFIQEEFQHLKTQAEQLHNHLQP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BTHS, CMD3A, EFE, EFE2, G4.5, XAP-2
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16635
HTS Code 3002150000
Gene ID 6901
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TAZ Antibody 25ul

Anti-TAZ Antibody 25ul