NLRP14,CLR11.2
  • NLRP14,CLR11.2

Anti-NLRP14 Antibody 100ul

Ref: AN-HPA039477-100ul
Anti-NLRP14

Información del producto

Polyclonal Antibody against Human NLRP14, Gene description: NLR family, pyrin domain containing 14, Alternative Gene Names: CLR11.2, GC-LRR, Nalp-iota, NALP14, NOD5, PAN8, Validated applications: IHC, Uniprot ID: Q86W24, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name NLRP14
Gene Description NLR family, pyrin domain containing 14
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence EKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVLGDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVK
Immunogen EKAWSVSLKIFGKMNLKDLCERAKEEINWSAQTIGPDDAKAGETQEDQEAVLGDGTEYRNRIKEKFCITWDKKSLAGKPEDFHHGIAEKDRKLLEHLFDVDVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CLR11.2, GC-LRR, Nalp-iota, NALP14, NOD5, PAN8
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86W24
HTS Code 3002150000
Gene ID 338323
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NLRP14 Antibody 100ul

Anti-NLRP14 Antibody 100ul