RPS6KB1
  • RPS6KB1

Anti-RPS6KB1 Antibody 100ul

Ref: AN-HPA039442-100ul
Anti-RPS6KB1

Información del producto

Polyclonal Antibody against Human RPS6KB1, Gene description: ribosomal protein S6 kinase, 70kDa, polypeptide 1, Alternative Gene Names: p70(S6K)-alpha, PS6K, S6K1, STK14A, Validated applications: ICC, IHC, WB, Uniprot ID: P23443, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RPS6KB1
Gene Description ribosomal protein S6 kinase, 70kDa, polypeptide 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK
Immunogen VSPVKFSPGDFWGRGASASTANPQTPVEYPMETSGIEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names p70(S6K)-alpha, PS6K, S6K1, STK14A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P23443
HTS Code 3002150000
Gene ID 6198
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-RPS6KB1 Antibody 100ul

Anti-RPS6KB1 Antibody 100ul