SPRYD3,FLJ14800
  • SPRYD3,FLJ14800

Anti-SPRYD3 Antibody 25ul

Ref: AN-HPA039426-25ul
Anti-SPRYD3

Información del producto

Polyclonal Antibody against Human SPRYD3, Gene description: SPRY domain containing 3, Alternative Gene Names: FLJ14800, Validated applications: ICC, IHC, WB, Uniprot ID: Q8NCJ5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPRYD3
Gene Description SPRY domain containing 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC, ICC
Sequence LARKDYPKNRHPGWSRGSVAYHADDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVRNVRNVMYLH
Immunogen LARKDYPKNRHPGWSRGSVAYHADDGKIFHGSGVGDPFGPRCYKGDIMGCGIMFPRDYILDSEGDSDDSCDTVILSPTARAVRNVRNVMYLH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14800
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NCJ5
HTS Code 3002150000
Gene ID 84926
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SPRYD3 Antibody 25ul

Anti-SPRYD3 Antibody 25ul