CCP110,CP110
  • CCP110,CP110

Anti-CCP110 Antibody 100ul

Ref: AN-HPA039402-100ul
Anti-CCP110

Información del producto

Polyclonal Antibody against Human CCP110, Gene description: centriolar coiled coil protein 110kDa, Alternative Gene Names: CP110, KIAA0419, Validated applications: ICC, IHC, Uniprot ID: O43303, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCP110
Gene Description centriolar coiled coil protein 110kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence DKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGK
Immunogen DKPSLNKSNVLLQGASTQASSMSMPVLASFSKVDIPIRTGHPTVLESNSDFKVIPTFVTENNVIKSLTGSYAKLPSPEPSMSPKMHRRRSRTSSACHILINNPINACELSPKGK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CP110, KIAA0419
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O43303
HTS Code 3002150000
Gene ID 9738
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CCP110 Antibody 100ul

Anti-CCP110 Antibody 100ul