CHID1,FLJ42707
  • CHID1,FLJ42707

Anti-CHID1 Antibody 100ul

Ref: AN-HPA039374-100ul
Anti-CHID1

Información del producto

Polyclonal Antibody against Human CHID1, Gene description: chitinase domain containing 1, Alternative Gene Names: FLJ42707, MGC3234, Validated applications: IHC, WB, Uniprot ID: Q9BWS9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CHID1
Gene Description chitinase domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
Immunogen KTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ42707, MGC3234
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BWS9
HTS Code 3002150000
Gene ID 66005
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-CHID1 Antibody 100ul

Anti-CHID1 Antibody 100ul