ERP29,C12orf8,ERp28
  • ERP29,C12orf8,ERp28

Anti-ERP29 Antibody 100ul

Ref: AN-HPA039363-100ul
Anti-ERP29

Información del producto

Polyclonal Antibody against Human ERP29, Gene description: endoplasmic reticulum protein 29, Alternative Gene Names: C12orf8, ERp28, ERp29, ERp31, PDI-DB, PDIA9, Validated applications: IHC, WB, Uniprot ID: P30040, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ERP29
Gene Description endoplasmic reticulum protein 29
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV
Immunogen SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C12orf8, ERp28, ERp29, ERp31, PDI-DB, PDIA9
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30040
HTS Code 3002150000
Gene ID 10961
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ERP29 Antibody 100ul

Anti-ERP29 Antibody 100ul