SFSWAP,SFRS8,SWAP
  • SFSWAP,SFRS8,SWAP

Anti-SFSWAP Antibody 25ul

Ref: AN-HPA039362-25ul
Anti-SFSWAP

Información del producto

Polyclonal Antibody against Human SFSWAP, Gene description: splicing factor, suppressor of white-apricot family, Alternative Gene Names: SFRS8, SWAP, Validated applications: ICC, IHC, Uniprot ID: Q12872, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SFSWAP
Gene Description splicing factor, suppressor of white-apricot family
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence NYLHPSLFASKKCNRLEELMKPLKVVDPDHPLAALVRKAQADSSTPTPHNADGAPVQPSQVEYTADSTVAAMYYSYYMLPDGTYCLAPPPPGIDVTTY
Immunogen NYLHPSLFASKKCNRLEELMKPLKVVDPDHPLAALVRKAQADSSTPTPHNADGAPVQPSQVEYTADSTVAAMYYSYYMLPDGTYCLAPPPPGIDVTTY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names SFRS8, SWAP
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12872
HTS Code 3002150000
Gene ID 6433
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-SFSWAP Antibody 25ul

Anti-SFSWAP Antibody 25ul