WDR73,FLJ14888
  • WDR73,FLJ14888

Anti-WDR73 Antibody 100ul

Ref: AN-HPA039357-100ul
Anti-WDR73

Información del producto

Polyclonal Antibody against Human WDR73, Gene description: WD repeat domain 73, Alternative Gene Names: FLJ14888, HSPC264, Validated applications: IHC, WB, Uniprot ID: Q6P4I2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WDR73
Gene Description WD repeat domain 73
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence ISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDW
Immunogen ISGFDGTVQVYDATSWDGTRSQDGTRSQVEPLFTHRGHIFLDGNGMDPAPLVTTHTWHPCRPRTLLSATNDASLHVWDW
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ14888, HSPC264
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6P4I2
HTS Code 3002150000
Gene ID 84942
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-WDR73 Antibody 100ul

Anti-WDR73 Antibody 100ul