ACSS3,FLJ21963
  • ACSS3,FLJ21963

Anti-ACSS3 Antibody 25ul

Ref: AN-HPA039353-25ul
Anti-ACSS3

Información del producto

Polyclonal Antibody against Human ACSS3, Gene description: acyl-CoA synthetase short-chain family member 3, Alternative Gene Names: FLJ21963, Validated applications: IHC, WB, Uniprot ID: Q9H6R3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ACSS3
Gene Description acyl-CoA synthetase short-chain family member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQ
Immunogen EYKTHFAASVTDPERFWGKAAEQISWYKPWTKTLENKHSPSTRWFVEGMLNICYNAVDRHIENGKGDKIAIIYDSPVTNTKATFTYKEVLEQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ21963
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H6R3
HTS Code 3002150000
Gene ID 79611
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-ACSS3 Antibody 25ul

Anti-ACSS3 Antibody 25ul