USPL1,bA121O19.1
  • USPL1,bA121O19.1

Anti-USPL1 Antibody 100ul

Ref: AN-HPA039342-100ul
Anti-USPL1

Información del producto

Polyclonal Antibody against Human USPL1, Gene description: ubiquitin specific peptidase like 1, Alternative Gene Names: bA121O19.1, C13orf22, D13S106E, Validated applications: IHC, Uniprot ID: Q5W0Q7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name USPL1
Gene Description ubiquitin specific peptidase like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence YCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNP
Immunogen YCPACREKGKLKALKTYRISFQESIFLCEDLQCIYPLGSKSLNNLISPDLEECHTPHKPQKRKSLESSYKDSLLLANSKKTRNYIAIDGGKVLNSKHNGEVYDETSSNLPDSSGQQNP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA121O19.1, C13orf22, D13S106E
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5W0Q7
HTS Code 3002150000
Gene ID 10208
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-USPL1 Antibody 100ul

Anti-USPL1 Antibody 100ul