POLR1D,MGC9850
  • POLR1D,MGC9850

Anti-POLR1D Antibody 100ul

Ref: AN-HPA039337-100ul
Anti-POLR1D

Información del producto

Polyclonal Antibody against Human POLR1D, Gene description: polymerase (RNA) I polypeptide D, 16kDa, Alternative Gene Names: MGC9850, RPA16, RPA9, RPAC2, RPO1-3, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y2S0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name POLR1D
Gene Description polymerase (RNA) I polypeptide D, 16kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB, IHC
Sequence EAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRS
Immunogen EAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC9850, RPA16, RPA9, RPAC2, RPO1-3
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y2S0
HTS Code 3002150000
Gene ID 51082
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-POLR1D Antibody 100ul

Anti-POLR1D Antibody 100ul