UNC45A,GC-UNC45
  • UNC45A,GC-UNC45

Anti-UNC45A Antibody 25ul

Ref: AN-HPA039228-25ul
Anti-UNC45A

Información del producto

Polyclonal Antibody against Human UNC45A, Gene description: unc-45 homolog A (C. elegans), Alternative Gene Names: GC-UNC45, SMAP-1, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H3U1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name UNC45A
Gene Description unc-45 homolog A (C. elegans)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
Immunogen QELQHRGAVVVLNMVEASREIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names GC-UNC45, SMAP-1
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H3U1
HTS Code 3002150000
Gene ID 55898
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-UNC45A Antibody 25ul

Anti-UNC45A Antibody 25ul