TEX35,C1orf49
  • TEX35,C1orf49

Anti-TEX35 Antibody 25ul

Ref: AN-HPA039190-25ul
Anti-TEX35

Información del producto

Polyclonal Antibody against Human TEX35, Gene description: testis expressed 35, Alternative Gene Names: C1orf49, DKFZP564J047, TSC24, Validated applications: IHC, WB, Uniprot ID: Q5T0J7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TEX35
Gene Description testis expressed 35
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence KQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRP
Immunogen KQIKDLMDKDFDKLHEFVEIMKEMQKDMDEKMDILINTQKNYKLPLRRAPKEQQELRLMGKTHREPQLRP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf49, DKFZP564J047, TSC24
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T0J7
HTS Code 3002150000
Gene ID 84066
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-TEX35 Antibody 25ul

Anti-TEX35 Antibody 25ul