HSPA4L,APG-1,HSPH3
  • HSPA4L,APG-1,HSPH3

Anti-HSPA4L Antibody 25ul

Ref: AN-HPA039149-25ul
Anti-HSPA4L

Información del producto

Polyclonal Antibody against Human HSPA4L, Gene description: heat shock 70kDa protein 4-like, Alternative Gene Names: APG-1, HSPH3, Osp94, Validated applications: ICC, IHC, WB, Uniprot ID: O95757, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HSPA4L
Gene Description heat shock 70kDa protein 4-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence KCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY
Immunogen KCHAEHTPEEEIDHTGAKTKSAVSDKQDRLNQTLKKGKVKSIDLPIQSSLCRQLGQDLLNSY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names APG-1, HSPH3, Osp94
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O95757
HTS Code 3002150000
Gene ID 22824
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-HSPA4L Antibody 25ul

Anti-HSPA4L Antibody 25ul