KLRB1,CD161,CLEC5B
  • KLRB1,CD161,CLEC5B

Anti-KLRB1 Antibody 25ul

Ref: AN-HPA039113-25ul
Anti-KLRB1

Información del producto

Polyclonal Antibody against Human KLRB1, Gene description: killer cell lectin-like receptor subfamily B, member 1, Alternative Gene Names: CD161, CLEC5B, hNKR-P1A, NKR, NKR-P1, NKR-P1A, Validated applications: IHC, Uniprot ID: Q12918, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name KLRB1
Gene Description killer cell lectin-like receptor subfamily B, member 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Immunogen KCSVDIQQSRNKTTERPGLLNCPIYWQQLREKCLLFSHTVNPWNNSLADCSTKESSLLLIRDKDELIH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CD161, CLEC5B, hNKR-P1A, NKR, NKR-P1, NKR-P1A
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12918
HTS Code 3002150000
Gene ID 3820
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-KLRB1 Antibody 25ul

Anti-KLRB1 Antibody 25ul