DDX23,prp28,PRPF28
  • DDX23,prp28,PRPF28

Anti-DDX23 Antibody 100ul

Ref: AN-HPA039037-100ul
Anti-DDX23

Información del producto

Polyclonal Antibody against Human DDX23, Gene description: DEAD (Asp-Glu-Ala-Asp) box polypeptide 23, Alternative Gene Names: prp28, PRPF28, SNRNP100, U5-100K, Validated applications: ICC, WB, Uniprot ID: Q9BUQ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DDX23
Gene Description DEAD (Asp-Glu-Ala-Asp) box polypeptide 23
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, ICC
Sequence REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM
Immunogen REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names prp28, PRPF28, SNRNP100, U5-100K
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BUQ8
HTS Code 3002150000
Gene ID 9416
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-DDX23 Antibody 100ul

Anti-DDX23 Antibody 100ul