FDXACB1,hCG_2033039
  • FDXACB1,hCG_2033039

Anti-FDXACB1 Antibody 100ul

Ref: AN-HPA039012-100ul
Anti-FDXACB1

Información del producto

Polyclonal Antibody against Human FDXACB1, Gene description: ferredoxin-fold anticodon binding domain containing 1, Alternative Gene Names: hCG_2033039, LOC91893, Validated applications: IHC, Uniprot ID: Q9BRP7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FDXACB1
Gene Description ferredoxin-fold anticodon binding domain containing 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence HPIKTINEKLIAELGKVFPLKRLKCSYPLLPQEGTSVLPFWNCDFLSAAFWISLHEDNSNSESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCG
Immunogen HPIKTINEKLIAELGKVFPLKRLKCSYPLLPQEGTSVLPFWNCDFLSAAFWISLHEDNSNSESLTGGTSQDVEDFLVSFSELSLLKNPGRDGKEEACEGTCG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hCG_2033039, LOC91893
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BRP7
HTS Code 3002150000
Gene ID 91893
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-FDXACB1 Antibody 100ul

Anti-FDXACB1 Antibody 100ul