NRG2,Don-1,HRG2,NTAK
  • NRG2,Don-1,HRG2,NTAK

Anti-NRG2 Antibody 25ul

Ref: AN-HPA038935-25ul
Anti-NRG2

Información del producto

Polyclonal Antibody against Human NRG2, Gene description: neuregulin 2, Alternative Gene Names: Don-1, HRG2, NTAK, Validated applications: ICC, Uniprot ID: O14511, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name NRG2
Gene Description neuregulin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMK
Immunogen GSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISVGSCVPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKMK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names Don-1, HRG2, NTAK
Categoria Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14511
HTS Code 3002150000
Gene ID 9542
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar un mensaje


Anti-NRG2 Antibody 25ul

Anti-NRG2 Antibody 25ul